PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G046000.1
Common NamePHAVU_003G046000g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB_related
Protein Properties Length: 279aa    MW: 31127.6 Da    PI: 9.3142
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G046000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.51.8e-191461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +grWT+eEd++l+d+v ++G ++W++++++ g+ R++k+c++rw +yl
  Phvul.003G046000.1 14 KGRWTPEEDKKLLDYVGKHGHRNWRLVPAKAGLERCGKSCRLRWINYL 61
                        79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.8E-25664IPR009057Homeodomain-like
PROSITE profilePS5129425.066965IPR017930Myb domain
SMARTSM007174.2E-151363IPR001005SANT/Myb domain
PfamPF002491.4E-171461IPR001005SANT/Myb domain
SuperFamilySSF466893.71E-231589IPR009057Homeodomain-like
CDDcd001672.10E-121661No hitNo description
Gene3DG3DSA:1.10.10.601.5E-86588IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MGRKGCCEKL GLKKGRWTPE EDKKLLDYVG KHGHRNWRLV PAKAGLERCG KSCRLRWINY  60
LKPDIKRGNF STEEDHTIIQ LHALLGNKLI RMSLDPITIT HKTIKQNTFE GCGDGQDQSK  120
DTINIRHVAQ WERARFEAEA RGSMLQVGSG SSNLSGLILS KIPTQPCLSS HSVSTENKRV  180
HNMYALVLTT NHDFRSSVST LSITKLPAVS NIPQNTNTKS LLAYKADNNV MGASTQIRKV  240
MEGCVSNLQD DDIMVAVEAF RTARCESIEE LLNEFTSM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-161293585B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150431e-153AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007153562.10.0hypothetical protein PHAVU_003G046000g
TrEMBLV7C9G10.0V7C9G1_PHAVU; Uncharacterized protein
STRINGGLYMA02G12242.11e-134(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13536826
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01140.12e-45myb domain protein 106